Invitrogen™ Human ZNF48 Control Fragment Recombinant Protein

Product Code. 30211879

Brand: Invitrogen™ RP93626

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (61%), Rat (61%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54891 (PA5-54891. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZNF48, also named as zinc finger protein 48, is 618 amino acid protein, which contains twelves C2H2-type zinc fingers and belongs to the Krueppel C2H2-type zinc-finger protein family. ZNF48 localizes in the nucleus and may be involves in transcription regulation.

Specifications

• Accession Number: Q96MX3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 197407
• Name: Human ZNF48 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Zinc finger protein 48; zinc finger protein 553; ZNF48; ZNF553
• Common Name: ZNF48
• Gene Symbol: ZNF48
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GLGSENVISQPNEFEHTPQEDDLGFKEEDLAPDHEVGNVSLKPEGIQNWDDLWVQREGLGKPQPRDRGPRLLGEPRWGQASSDRA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining