missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30194733

Invitrogen™ Human ZNF446 (aa 336-399) Control Fragment Recombinant Protein

Product Code. 30194733
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194733

Brand: Invitrogen™ RP101118

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (38%), Rat (38%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140015 (PA5-140015. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZNF446 contains a KRAB and three C(2)H(2) zinc fingers. ZNF446 is a transcription repressor when fused to GAL4 DNA-binding domain and co-transfected with VP-16. Overexpression of ZNF446 in COS-7 cells inhibits the transcriptional activities of SRE.
TRUSTED_SUSTAINABILITY

Specifikationer

Accession Number Q9NWS9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55663
Name Human ZNF446 (aa 336-399) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias FLJ20626; Zinc finger protein 446; zinc finger protein with KRAB and SCAN domains 20; ZKSCAN20; ZNF446; ZSCAN30; ZSCAN52
Common Name ZNF446
Gene Symbol ZNF446
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QCGRGFDWKSVFVIHHRTHTSGPGVQSPGLATGESTEKPPQGEVAFPHHPRRSLTGPRSYPCEE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.