Invitrogen™ Human ZNF435 (aa 250-327) Control Fragment Recombinant Protein

Product Code. 30194199

Brand: Invitrogen™ RP89437

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52417 (PA5-52417. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZNF435 contains 1 SCAN box domain and 4 C2H2-type zinc fingers. It belongs to the kruppel C2H2-type zinc finger protein family and may be involved in transcriptional regulation.

Specifications

• Accession Number: Q9H4T2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 80345
• Name: Human ZNF435 (aa 250-327) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: dJ265C24.3; zinc finger and SCAN domain containing 16; zinc finger and SCAN domain-containing protein 16; Zinc finger protein 392; zinc finger protein 435; ZNF392; ZNF435; ZSCAN16
• Common Name: ZNF435
• Gene Symbol: ZSCAN16
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DLSKHRRTHTGEKPYKCDECGKAFIQRSHLIGHHRVHTGVKPYKCKECGKDFSGRTGLIQHQRIHTGEKPYECDECGR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining