Invitrogen™ Human ZNF423 (aa 347-407) Control Fragment Recombinant Protein

Product Code. 30208787

Brand: Invitrogen™ RP107457

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66798 (PA5-66798. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Transcription factor that can both act as an activator or a repressor depending on the context. Plays a central role in BMP signaling and olfactory neurogenesis. Associates with SMADs in response to BMP2 leading to activate transcription of BMP target genes. Acts as a transcriptional repressor via its interaction with EBF1, a transcription factor involved in terminal olfactory receptor neurons differentiation; this interaction preventing EBF1 to bind DNA and activate olfactory-specific genes. Involved in olfactory neurogenesis by participating in a developmental switch that regulates the transition from differentiation to maturation in olfactory receptor neurons. Controls proliferation and differentiation of neural precursors in cerebellar vermis formation.

Specifications

• Accession Number: Q2M1K9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23090
• Name: Human ZNF423 (aa 347-407) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: early B-cell factor associated zinc finger protein; Ebfaz; hOAZ; JBTS19; KIAA0760; NPHP14; OAZ; OLF-1/EBF associated zinc finger; olf1/EBF-associated zinc finger protein; Roaz; Smad- and Olf-interacting zinc finger protein; Zfp104; ZFP423; zinc finger protein 423; ZNF423
• Common Name: ZNF423
• Gene Symbol: ZNF423
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QPDSSNHSVSPDPVLGSVASMSSATPDSSASVERGSTPDSTLKPLRGQKKMRDDGQGWTKV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining