Invitrogen™ Human ZNF408 (aa 189-338) Control Fragment Recombinant Protein

Product Code. 30209872

Brand: Invitrogen™ RP91666

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (40%), Rat (40%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53660 (PA5-53660. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Zinc-finger proteins contain DNA-binding domains and have a wide variety of functions, most of which encompass some form of transcriptional activation or repression. The majority of zinc-finger proteins contain a Kruppel-type DNA binding domain and a KRAB domain, which is thought to interact with KAP1, thereby recruiting histone modifying proteins. As a member of the Kruppel C2H2-type zinc-finger protein family, ZNF396 (zinc finger protein 396), also known as PRDM17 (PR domain zinc finger protein 17), is a 720 amino acid nuclear protein that contains 10 C2H2-type zinc fingers. The gene encoding ZNF408 maps to human chromosome 11, which houses over 1,400 genes and comprises nearly 4% of the human genome. Jervell and Lange-Nielsen syndrome, Jacobsen syndrome, Niemann-Pick disease, hereditary angioedema and Smith-Lemli-Opitz syndrome are associated with defects in genes that maps to chromosome 11.

Specifications

• Accession Number: Q9H9D4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79797
• Name: Human ZNF408 (aa 189-338) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: EVR6; LOC100362202; PFM14; PR domain zinc finger protein 17; PRDM17; RP72; Zinc finger protein 408; ZNF408
• Common Name: ZNF408
• Gene Symbol: ZNF408
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AAVAVVTEVESAVQQEVASPGEDAAEPCIDPGSQSPSGIQAENMVSPGLKFPTQDRISKDSQPLGPLLQDGDVDEECPAQAQMPPELQSNSATQQDPDGSGASFSSSARGTQPHGYLAKKLHSPSDQCPPRAKTPEPGAQQSGFPTLSRS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining