Invitrogen™ Human ZNF404 (aa 43-94) Control Fragment Recombinant Protein

Product Code. 30210355

Brand: Invitrogen™ RP108491

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (29%), Rat (29%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84605 (PA5-84605. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZNF404 (Zinc Finger Protein 404) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene includenucleic acid binding.

Specifications

• Accession Number: Q494X3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 342908
• Name: Human ZNF404 (aa 43-94) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Zinc finger protein 404; ZNF404
• Common Name: ZNF404
• Gene Symbol: ZNF404
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VSLDFNFTTESNKLSSEKRNYEVNAYHQETWKRNKTFNLMRFIFRTDPQYTI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining