Invitrogen™ Human ZNF398 (aa 328-395) Control Fragment Recombinant Protein

Product Code. 30201176

Brand: Invitrogen™ RP109851

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145042 (PA5-145042. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Function as a transcriptional activator.

Specifications

• Accession Number: Q8TD17
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57541
• Name: Human ZNF398 (aa 328-395) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: KIAA1339; P51; P71; ZER6; zinc finger DNA binding protein p52/p71; zinc finger DNA binding protein ZER6; zinc finger DNA-binding protein p52/p71; Zinc finger protein 398; zinc finger-estrogen receptor interaction, clone 6; ZNF398
• Common Name: ZNF398
• Gene Symbol: ZNF398
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QLGSYPLPPPVGEQVFSCHHCGKNLSQDMLLTHQCSHATEHPLPCAQCPKHFTPQADLSSTSQDHASE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining