Invitrogen™ Human ZNF385B (aa 178-237) Control Fragment Recombinant Protein

Product Code. 30200009

Brand: Invitrogen™ RP104813

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65425 (PA5-65425. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZNF385B contains 4 U1-type zinc fingers. ZNF385B is expressed in brain with a potential role in RNA maturation, stability, or transcription regulation. There are 5 known isoforms.

Specifications

• Accession Number: Q569K4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 151126
• Name: Human ZNF385B (aa 178-237) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: B830010L13Rik; C130013B13Rik; si:busm1-42h5.1; si:by51i9.1; si:dz145b16.1; si:dz42h5.1; si:xx-51i9.1; wu:fj47d04; ZFN533; Zfp385b; Zfp533; zgc:73248; Zinc finger protein 385 B; zinc finger protein 533; ZNF385B; ZNF533
• Common Name: ZNF385B
• Gene Symbol: ZNF385B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GSKHAKKVKALDATKNKPKMVPSKDSAKANPSCSITPITGNNSDKSEDKGKLKASSSSQP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining