Invitrogen™ Human ZNF346 (aa 218-292) Control Fragment Recombinant Protein

Product Code. 30204193

Brand: Invitrogen™ RP92029

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82630 (PA5-82630. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Probable transcriptional activator which may play a role in neuronal differentiation. Able to bind DNA and activate expression in vitro.

Specifications

• Accession Number: Q9UL40
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23567
• Name: Human ZNF346 (aa 218-292) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: double-stranded RNA-binding zinc finger protein JAZ; Jaz; Just another zinc finger protein; Zfp346; Zinc finger protein 346; ZNF346
• Common Name: ZNF346
• Gene Symbol: ZNF346
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LMARYGRLADPAVTDFPAGKGYPCKTCKIVLNSIEQYQAHVSGFKHKNQSPKTVASSLGQIPMQRQPIQKDSTTL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining