Invitrogen™ Human ZNF33A (aa 84-117) Control Fragment Recombinant Protein

Product Code. 30204712

Brand: Invitrogen™ RP104509

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (35%), Rat (35%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63335 (PA5-63335. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZNF33A belongs to the krueppel C2H2-type zinc-finger protein family. It contains 16 C2H2-type zinc fingers and 1 KRAB domain. ZNF33A may be involved in transcriptional regulation.

Specifications

• Accession Number: Q06730
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7581
• Name: Human ZNF33A (aa 84-117) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: brain my041 protein; KIAA0065; KO x 2; KO x 31; KO x 5; NF11A; Zinc finger and ZAK-associated protein with KRAB domain; zinc finger protein 11 A; Zinc finger protein 33 A; zinc finger protein 33 A (KOX 31); zinc finger protein KO x 31; ZNF11; ZNF11A; ZNF33; ZNF33A; ZZAPK
• Common Name: ZNF33A
• Gene Symbol: ZNF33A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VWTADHLKERSQENQSKHLWEVVFINNEMLTKEQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining