Invitrogen™ Human ZNF329 (aa 71-139) Control Fragment Recombinant Protein

Product Code. 30207337

Brand: Invitrogen™ RP93629

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (49%), Rat (49%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60693 (PA5-60693. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Zinc finger proteins contain DNA-binding domains and have a wide variety of functions, most of which encompass some form of transcriptional activation or repression. The majority of zinc finger proteins contain a Kruppeltype DNA binding domain and a KRAB domain, which is thought to interact with KAP1, thereby recruiting histone modifying proteins. As a member of the Krueppel C2H2-type zinc finger protein family, ZNF329 (zinc finger protein 329) is a 541 amino acid nuclear protein that contains twelve C2H2-type zinc fingers through which it is thought to be involved in DNA-binding and transcriptional regulation.

Specifications

• Accession Number: Q86UD4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79673
• Name: Human ZNF329 (aa 71-139) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810439M05Rik; 4632409L22Rik; RGD1565029; Zfp329; Zinc finger protein 329; Znf329
• Common Name: ZNF329
• Gene Symbol: ZNF329
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EHLIASSDLPPSQRVLATNGFHAPDSNVSGLDCDPALPSYPKSYADKRTGDSDACGKGFNHSMEVIHGR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining