missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30207173

Invitrogen™ Human ZNF326 (aa 188-265) Control Fragment Recombinant Protein

Product Code. 30207173
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30207173

Brand: Invitrogen™ RP94402

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55863 (PA5-55863. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Core component of the DBIRD complex, a multiprotein complex that acts at the interface between core mRNP particles and RNA polymerase II (RNAPII) and integrates transcript elongation with the regulation of alternative splicing: the DBIRD complex affects local transcript elongation rates and alternative splicing of a large set of exons embedded in (A + T)-rich DNA regions. May play a role in neuronal differentiation and is able to bind DNA and activate expression in vitro. [UniProt]
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q5BKZ1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 284695
Name Human ZNF326 (aa 188-265) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5730470H14Rik; DBIRD complex subunit ZNF326; dJ871E2.1; dJ871E2.1 (novel protein (ortholog of mouse zinc finger protein Zan75)); Zan75; Zfp326; zinc finger protein 326; zinc finger protein 326; DBIRD complex subunit ZNF326; zinc finger protein interacting with mRNPs; Zinc finger protein interacting with mRNPs and DBC1; zinc finger protein-associated with nuclear matrix of 75 kDa; Zird; ZNF326; ZNF-protein interacting with nuclear mRNPs and DBC1
Common Name ZNF326
Gene Symbol ZNF326
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RNYDAFGGPSTGRGRGRGHMGDFGSIHRPGIVVDYQNKSTNVTVAAARGIKRKMMQPFNKPSGTFIKKPKLAKPMEKI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.