Invitrogen™ Human ZNF323 (aa 108-215) Control Fragment Recombinant Protein

Product Code. 30212663

Brand: Invitrogen™ RP89443

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (35%), Rat (35%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52387 (PA5-52387. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZNF323 is a member of the subfamily of C2H2 Kruppel-like zinc finger transcription factors that have a SCAN box domain (Pi et al., 2002 ).

Specifications

• Accession Number: Q96LW9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 64288
• Name: Human ZNF323 (aa 108-215) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: dJ874C20.2; zinc finger and SCAN domain containing 31; zinc finger and SCAN domain-containing protein 31; Zinc finger protein 323; ZNF20-Lp; ZNF310P; ZNF323; ZSCAN31
• Common Name: ZNF323
• Gene Symbol: ZSCAN31
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EEAVAVVEDLEQELSEPGNQAPDHEHGHSEVLLEDVEHLKVKQEPTDIQLQPMVTQLRYESFCLHQFQEQDGESIPENQELASKQEILKEMEHLGDSKLQRDVSLDSK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining