Invitrogen™ Human ZNF31 (aa 545-678) Control Fragment Recombinant Protein

Product Code. 30209883

Brand: Invitrogen™ RP91317

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (64%), Rat (64%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53673 (PA5-53673. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May be involved in transcriptional regulation.

Specifications

• Accession Number: P17040
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7579
• Name: Human ZNF31 (aa 545-678) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C130001F22; KOX29; Zfp31; ZFP-31; zinc finger and SCAN domain containing 20; zinc finger and SCAN domain-containing protein 20; zinc finger and SCAN domains 20; zinc finger protein 31; Zinc finger protein 360; zinc finger protein KOX29; zinc finger with KRAB and SCAN domains 20; Zkscan20; ZNF31; ZNF360; ZSCAN20
• Common Name: ZNF31
• Gene Symbol: ZSCAN20
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RSYRKAKSSHPPGTCPFYEELDSLMRARAAVRAMGTVREAAGLPRCGQSSAETDAQEAWGEVANEDAVKPSTLCPKAPDMGFEMRHEDEDQISEQDIFEGLPGALSKCPTEAVCQPLDWGEDSENENEDEGQWG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining