Invitrogen™ Human ZNF297B (aa 286-397) Control Fragment Recombinant Protein

Product Code. 30201101

Brand: Invitrogen™ RP91658

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53499 (PA5-53499. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZNF297B is a candidate transcription factor

Specifications

• Accession Number: O43298
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23099
• Name: Human ZNF297B (aa 286-397) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700010E06Rik; Kiaa0414; mKIAA0414; ortholog of zinc finger protein 297 B ZNF297B; ZBTB22B; ZBTB43; Zfp297b; zinc finger and BTB domain containing 43; zinc finger and BTB domain-containing protein 22 B; Zinc finger and BTB domain-containing protein 43; zinc finger protein 297 B; Znf297b; ZNF-X
• Common Name: ZNF297B
• Gene Symbol: ZBTB43
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GVEEDFHIGEKKVEAEFDEQADESNYDEQVDFYGSSMEEFSGERSDGNLIGHRQEAALAAGYSENIEMVTGIKEEASHLGFSATDKLYPCQCGKSFTHKSQRDRHMSMHLGL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining