Invitrogen™ Human ZNF295 (aa 998-1066) Control Fragment Recombinant Protein

Product Code. 30201233

Brand: Invitrogen™ RP105865

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZNF295 contains 1 BTB (POZ) domain and 8 C2H2-type zinc fingers. ZNF295 may be involved in transcriptional regulation.

Specifications

• Accession Number: Q9ULJ3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 49854
• Name: Human ZNF295 (aa 998-1066) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5430437K12Rik; B430213I24Rik; KIAA1227; mKIAA1227; ZBTB21; Zfp295; zinc finger and BTB domain containing 21; zinc finger and BTB domain-containing protein 21; Zinc finger protein 295; ZNF295
• Common Name: ZNF295
• Gene Symbol: ZBTB21
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PLEPDSPTGLSENPTPATEKLFVPQESDTLFYHAPPLSAITFKRQFMCKLCHRTFKTAFSLWSHEQTHN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining