Invitrogen™ Human ZNF281 (aa 696-794) Control Fragment Recombinant Protein

Product Code. 30208912

Brand: Invitrogen™ RP101420

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62351 (PA5-62351. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZFP281, also known as ZBP-99, is a member of a conserved family of transcription factors that interact with GC-rich promoters. It contains four Kruppel-like zinc fingers and is highly homologous to ZBP-89, another regulator of ornithine decarboxylase gene expression. ZFP281 also interacts with many other other transcription factors, such as Sp1 to repress vimentin gene transcription. ZFP281 has also been shown to control embryonic stem cell pluripotency by direct regulating specific target genes. ZFP281 phyically interacts with the transcription factos POU5F1, Sox2, and NANOG. Gene expression microarray anlysis indicated that some ZFP281 target genes were activated, while others were repressed upon knockdown of ZFP281 expression, showing that ZFP281 plays bifuctinal roles in regulating gene expression in stem cells.

Specifications

• Accession Number: Q9Y2X9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23528
• Name: Human ZNF281 (aa 696-794) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: GC-box-binding zinc finger protein 1; GZP1; Transcription factor ZBP-99; ZBP99; ZBP-99; Zfp281; Zinc finger DNA-binding protein 99; zinc finger protein 281; ZNF281; ZNP-99; ZNP-99 transcription factor
• Common Name: ZNF281
• Gene Symbol: ZNF281
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SSPLHNHTLFPEKQIYTTSPLECGFGQSVTSVLPSSLPKPPFGMLFGSQPGLYLSALDATHQQLTPSQELDDLIDSQKNLETSSAFQSSSQKLTSQKEQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining