Invitrogen™ Human ZNF258 (aa 751-842) Control Fragment Recombinant Protein

Product Code. 30195843

Brand: Invitrogen™ RP107845

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67211 (PA5-67211. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZNF258 is part of a novel, putative, zinc-binding motif (MYM) family which encodes proteins that maintain the repeats of the MYM motif.

Specifications

• Accession Number: O95789
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9204
• Name: Human ZNF258 (aa 751-842) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Buster2; KIAA1353; MYM; transposase-like protein; transposon-derived Buster2 transposase-like protein; ZBED7; zinc finger MYM-type containing 6; zinc finger MYM-type protein 6; Zinc finger protein 258; zinc finger, BED-type containing 7; zinc finger, MYM-type 6; zinc finger, MYM-type containing 6; ZMYM6; ZNF198L4; ZNF258
• Common Name: ZNF258
• Gene Symbol: ZMYM6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VGFIICPGSKESSPRPQCVICGEILSSENMKPANLSHHLKTKHSELENKPVDFFEQKSLEMECQNSSLKKCLLVEKSLVKASYLIAFQTAAS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining