Invitrogen™ Human ZNF25 (aa 41-128) Control Fragment Recombinant Protein

Product Code. 30207799

Brand: Invitrogen™ RP95529

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (55%), Rat (55%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56391 (PA5-56391. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Zinc-finger proteins contain DNA-binding domains and have a wide variety of functions, most of which encompass some form of transcriptional activation or repression. The majority of zinc-finger proteins contain a Kruppel-type DNA binding domain and a KRAB domain, which is thought to interact with KAP1, thereby recruiting histone modifying proteins. As a member of the krueppel C2H2-type zinc-finger protein family, ZNF25 (Zinc finger protein 25), also known as Zinc finger protein KOX19, is a 456 amino acid nuclear protein that contains one KRAB domain and twelve C2H2-type zinc fingers. The gene encoding ZNF25 maps to a region of human chromosome 10 that has been a loci of interest for multiple endocrine neoplasia type 2A and 2B. There are two isoforms of ZNF25 that are produced as a result of alternative splicing events.

Specifications

• Accession Number: P17030
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 219749
• Name: Human ZNF25 (aa 41-128) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: KOX19; Zfp9; zinc finger protein 25; zinc finger protein 25 (KOX 19); zinc finger protein KOX19; ZNF25
• Common Name: ZNF25
• Gene Symbol: ZNF25
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YSHLVSVGYHVNKPNAVFKLKQGKEPWILEVEFPHRGFPEDLWSIHDLEARYQESQAGNSRNGELTKHQKTHTTEKACECKECGKFFC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining