Invitrogen™ Human ZNF23 (aa 102-202) Control Fragment Recombinant Protein

Product Code. 30209550

Brand: Invitrogen™ RP91693

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (43%), Rat (43%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82839 (PA5-82839. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZNF23 May be involved in transcriptional regulation. May have a role in embryonic development. Belongs to the krueppel C2H2-type zinc-finger protein family.

Specifications

• Accession Number: P17027
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7571
• Name: Human ZNF23 (aa 102-202) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: B230354B21Rik; KOX16; kruppel-like zinc finger factor X31; Zfp23; Zfp612; zinc finger protein 23; zinc finger protein 23 (KOX 16); zinc finger protein 32; zinc finger protein 359; Zinc finger protein 612; Zinc finger protein KOX16; ZNF23; ZNF359; ZNF612
• Common Name: ZNF23
• Gene Symbol: ZNF23
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KSNTIDGTVKDETSPVEECFFSQSSNSYQCHTITGEQPSGCTGLGKSISFDTKLVKHEIINSEERPFKCEELVEPFRCDSQLIQHQENNTEEKPYQCSECG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining