Invitrogen™ Human ZNF22 (aa 1-54) Control Fragment Recombinant Protein

Product Code. 30212259

Brand: Invitrogen™ RP106580

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZNF22 encodes a protein that is expressed in the epithelial component of the developing tooth organ during early bud and cap stages as well as in osteoblasts of craniofacial bone and the developing tongue.

Specifications

• Accession Number: P17026
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7570
• Name: Human ZNF22 (aa 1-54) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2900028O21Rik; AU041373; HKR-T1; Ko x 15; Kro x 25; Krox-25; Krox-25-2; Kro x 26; Krox-26; krox-26 protein; krueppel-type zinc finger protein Krox-25; Zfp422; Zinc finger protein 22; zinc finger protein 22 (KOX 15); zinc finger protein 422; Zinc finger protein KO x 15; zinc finger protein Krox-25; Zinc finger protein Krox-26; ZNF22; ZNF422
• Common Name: ZNF22
• Gene Symbol: ZNF22
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MRLAKPKAGISRSSSQGKAYENKRKTGRQRQKWGMTIRFDSSFSRLRRSLDDKP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining