Invitrogen™ Human ZNF2 (aa 91-158) Control Fragment Recombinant Protein

Product Code. 30181439

Brand: Invitrogen™ RP98519

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (53%), Rat (53%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59533 (PA5-59533. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The ZNF2 gene is part of a sub-family of structurally related finger protein genes. Members of this sub-family are expressed as multiple transcripts in several cell lines.

Specifications

• Accession Number: Q9BSG1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7549
• Name: Human ZNF2 (aa 91-158) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810405K07Rik; A1-5; Mkr2; Mkr-2; multifinger protein mKr2; Zfp2; Zfp661; zfp-661; zinc finger protein 2; zinc finger protein 2 (A1-5); zinc finger protein 2 homolog; zinc finger protein 2.2; Zinc finger protein 661; ZNF2; ZNF661
• Common Name: ZNF2
• Gene Symbol: ZNF2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LDWETKPEIHDASDKKSEGSLRECLGRQSPLCPKFEVHTPNGRMGTEKQSPSGETRKKSLSRDKGLRR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining