Invitrogen™ Human ZNF197 (aa 253-325) Control Fragment Recombinant Protein

Product Code. 30195711

Brand: Invitrogen™ RP101574

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (27%), Rat (27%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84210 (PA5-84210. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZNF197 product belongs to the zinc finger protein superfamily, members of which are regulatory proteins characterized by nucleic acid-binding zinc finger domains. The encoded protein contains 20 tandemly arrayed C2H2-type zinc fingers, a Kruppel-associated box (KRAB) domain, and a SCAN box. This transcript turns over rapidly and contains 3' UTR AUUUA motifs, which are often a hallmark of rapid turnover. It is overexpressed in some thyroid papillary carcinomas. ZNF197 is located in a cluster of zinc finger genes at 3p21. Two alternatively spliced transcripts encoding different isoforms have been described.

Specifications

• Accession Number: O14709
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10168
• Name: Human ZNF197 (aa 253-325) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: D3S1363E; P18; pVHL-associated KRAB domain-containing protein; VHLaK; VHL-associated KRAB-A domain-containing protein; zinc finger protein 166; zinc finger protein 197; Zinc finger protein 197-like protein; zinc finger protein 20; zinc finger protein with KRAB and SCAN domains 9; ZKSCAN9; ZNF166; ZNF197; ZnF20; ZSCAN41
• Common Name: ZNF197
• Gene Symbol: ZNF197
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VTSLEWETMTENEEVTSKPSSSQRADSHKGTSKRLQGSVPQVLDFEEECEWQVLASQWGNETDERADTVKKVS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining