Invitrogen™ Human ZNF169 (aa 69-139) Control Fragment Recombinant Protein

Artikelnummer. 30198076

Marke: Invitrogen™ RP108993

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (55%), Rat (55%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZNF169 (Zinc finger protein 169) is a 603 amino acid nuclear protein that contains one KRAB domain and thirteen C2H2-type zinc fingers. ZNF169 is highly expressed in kidney and weakly expressed in spleen, liver, small intestine and heart, where it functions as a transcription regulator. The gene encoding ZNF169 maps to a region of human chromosome 9q22, which has been associated with many human diseases such as colon cancer, migraine auras, basal cell carcinoma, Gorlin syndrome and Extraskeletal myxoid chondrosarcoma.

Spezifikation

• Accession Number: Q14929
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 169841
• Name: Human ZNF169 (aa 69-139) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700025J14Rik; 4930429A13Rik; BE688704; RP11-307E17.10-001; Zfp169; Zinc finger protein 169; ZNF169
• Common Name: ZNF169
• Gene Symbol: ZNF169
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GDEPWREENEHLLDLCPEPRTEFQPSFPHLVAFSSSQLLRQYALSGHPTQIFPSSSAGGDFQLEAPRCSSE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining