Invitrogen™ Human ZNF112 (aa 61-201) Control Fragment Recombinant Protein

Product Code. 30182250

Brand: Invitrogen™ RP99637

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (37%), Rat (37%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54899 (PA5-54899. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZNF112 gene ontology annotations related to this gene include regulation of transcription, DNA-templated.

Especificaciones

• Accession Number: Q9UJU3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7771
• Name: Human ZNF112 (aa 61-201) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: LOW QUALITY PROTEIN: zinc finger protein 112; Zfp112; zfp-112; zinc finger protein 112; zinc finger protein 112 (Y14); zinc finger protein 112 homolog; zinc finger protein 112; zinc finger protein ZFP112; zinc finger protein 228; ZNF112; ZNF228
• Common Name: ZNF112
• Gene Symbol: ZNF112
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EREEKLLMVETETPRDGCSGRKNQQKMESIQEVTVSYFSPKELSSRQTWQQSAGGLIRCQDFLKVFQGKNSQLQEQGNSLGQVWAGIPVQISEDKNYIFTHIGNGSNYIKSQGYPSWRAHHSWRKMYLKESHNYQCRCQQI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining