missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ZMIZ2 (aa 270-339) Control Fragment Recombinant Protein

Product Code. 30200379
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200379

Brand: Invitrogen™ RP109798

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145018 (PA5-145018. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZIMP7, also known as ZMIZ2, is a novel PIAS (protein inhibitor of activated signal transducer and activator of transcription)-like protein and a transcriptional coactivator. ZIMP7 is expressed most abundantly in testis. The C-terminal proline-rich domain possesses a significant intrinsic transcriptional activity and this activity is inhibited by the N-terminus in the full-length ZIMP7. ZIMP7 and the related protein ZIMP10 interact with PIAS3 and enhances Androgen Receptor (AR)- mediated transcription. The interaction between ZIMP7 and SWI/SNF complex suggests a possible role for ZIMP7 in chromatin modification.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8NF64
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 83637
Name Human ZMIZ2 (aa 270-339) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias D11Bwg0280e; HRIHFB2007; hZIMP7; KIAA1886; NET27; PIAS-like protein Zimp7; TRAFIP20; Zimp7; zinc finger MIZ domain-containing protein 2; zinc finger MIZ-type containing 2; zinc finger, MIZ-type containing 2; Zmiz2
Common Name ZMIZ2
Gene Symbol ZMIZ2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SEVYPGQQYLQGGQYAPSTAQFAPSPGQPPAPSPSYPGHRLPLQQGMTQSLSVPGPTGLHYKPTEQFNGQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.