Invitrogen™ Human ZMIZ1 (aa 410-495) Control Fragment Recombinant Protein

Product Code. 30208966

Brand: Invitrogen™ RP109251

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140136 (PA5-140136. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Retinoic acid plays a critical role in development, cellular growth, and differentiation and induces the expression of a variety of genes. RAI17 expression is induced by retinoic acid and is predominantly expressed in heart, brain and ovaries. Within brain, highest expression is in amygdala. The deduced 1,067-amino acid protein contains an MSX-interacting zinc finger (MIZ) domain, a nuclear localization signal sequence, and 2 proline-rich regions. A strong intrinsic transactivation domain is identified in the C-terminal proline-rich region. RAI17 expression is detected in various cancer cell lines. RAI17 colocalizes with endogenous androgen receptor (AR) in the nuclei of prostate epithelial cells from human tissue samples. In human prostate cancer cells, RAI17 increases the transcriptional activity of AR. Studies using sumoylation-deficient AR mutants suggest that the increase of AR activity by RAI17 is dependent upon receptor sumoylation.

Specifications

• Accession Number: Q9ULJ6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57178
• Name: Human ZMIZ1 (aa 410-495) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BC065120; E330020C23; ENSMUSG00000072684; FLJ00092 protein; Gm10397; hZIMP10; I920194n01; KIAA1224; MIZ; PIAS-like protein Zimp10; Rai17; retinoic acid induced 17; retinoic acid-induced protein 17; RP11-519K18.1; TRAFIP10; Zimp10; Zinc finger MIZ domain-containing protein 1; zinc finger MIZ-type containing 1; zinc finger, MIZ-type containing 1; zinc finger-containing, Miz1, PIAS-like protein on chromosome 10; ZMIZ1
• Common Name: ZMIZ1
• Gene Symbol: ZMIZ1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EPNYGNQQYGPNSQFPTQPGQYPAPNPPRPLTSPNYPGQRMPSQPSSGQYPPPTVNMGQYYKPEQFNGQNNTFSGSSYSNYSQGNV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining