missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30211468

Invitrogen™ Human ZMAT3 (aa 221-289) Control Fragment Recombinant Protein

Product Code. 30211468
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211468

Brand: Invitrogen™ RP106535

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-82985 (PA5-82985, PA5-65864 (PA5-65864. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein containing three zinc finger domains and a nuclear localization signal. The mRNA and the protein of this gene are upregulated by wildtype p53 and overexpression of this gene inhibits tumor cell growth, suggesting that this gene may have a role in the p53-dependent growth regulatory pathway. Alternative splicing of this gene results in two transcript variants encoding two isoforms differing in only one amino acid.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9HA38
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 64393
Name Human ZMAT3 (aa 221-289) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias FLJ12296; matrin type 3; MGC10613; p53 target zinc finger protein; p53-activated gene 608 protein; Pag608; UniProtKB:Q9HA38}; Wig1; WIG-1; WIG-1/PAG608 protein; wild-type p53-induced gene 1; wild-type p53-induced gene 1 protein; zinc finger matrin type 3; zinc finger matrin-type 3; zinc finger matrin-type protein 3; zinc finger protein WIG1; Zinc finger protein WIG-1; zinc finger, matrin type 3; zmat3; zmat3 {ECO:0000250
Common Name ZMAT3
Gene Symbol ZMAT3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GPYFNPRSRQRIPRDLAMCVTPSGQFYCSMCNVGAGEEMEFRQHLESKQHKSKVSEQRYRNEMENLGYV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.