Invitrogen™ Human ZKSCAN2 (aa 120-190) Control Fragment Recombinant Protein

Product Code. 30202961

Brand: Invitrogen™ RP100979

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61894 (PA5-61894. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZKSCAN2 may be involved in transcriptional regulation.

Specifications

• Accession Number: Q63HK3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 342357
• Name: Human ZKSCAN2 (aa 120-190) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: FLJ23199; zinc finger and SCAN domain containing 31; zinc finger protein 694; Zinc finger protein with KRAB and SCAN domains 2; zinc finger with KRAB and SCAN domains 2; ZKSCAN2; ZNF694; ZSCAN31; ZSCAN34
• Common Name: ZKSCAN2
• Gene Symbol: ZKSCAN2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VVHLEKETGRLRQQVSSPVHREKHSPLGAAWEVADFQPEQVETQPRAVSREEPGSLHSGHQEQLNRKRERR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining