Invitrogen™ Human ZIP14 (aa 89-154) Control Fragment Recombinant Protein

Product Code. 30209514

Brand: Invitrogen™ RP108930

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140224 (PA5-140224. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The zinc transporter ZIP14, also known as SLC39A14, is a member of a family of divalent ion transporters. Zinc is an essential ion for cells and plays significant roles in the growth, development, and differentiation. The zinc transporter family is divided into four subfamilies (I, II, LIV-1 and gufA). ZIP14 is a glycosylated multipass plasma membrane protein that belongs to the ZIP transporter subfamily LIV-1. ZIP14 has been shown to contribute to the hypozincemia of inflammation and infection and is regulated in the liver by IL-6. In addition to zinc, ZIP14 is also involved in the cellular uptake of non-transferrin-bound iron as well as iron bound to transferrin.

Specifications

• Accession Number: Q15043
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23516
• Name: Human ZIP14 (aa 89-154) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: cig19; Factor for adipocyte differentiation 123; Fad123; FAD-123; HMNDYT2; Kiaa0062; LIV-1 subfamily of ZIP zinc transporter 4; LZT-Hs4; NET34; SLC39A14; solute carrier family 39 (metal ion transporter), member 14; solute carrier family 39 (zinc transporter), member 14; solute carrier family 39 member 14; Zinc transporter ZIP14; Zip14; ZIP-14; Zrt- and Cig19; Zrt- and Irt-like protein 14; Zrt-, Irt-like protein 14
• Common Name: ZIP14
• Gene Symbol: SLC39A14
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: STCFSSGDLFTAHNFSEQSRIGSSELQEFCPTILQQLDSRACTSENQENEENEQTEEGRPSAVEVW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining