Invitrogen™ Human ZIP10 (aa 69-148) Control Fragment Recombinant Protein

Product Code. 30202481

Brand: Invitrogen™ RP107478

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZIP10, also known as Slc39A10, is a widely expressed zinc transporter with nine transmembrane domains. Zinc is an essential ion for cells and plays significant roles in the growth, development, and differentiation. ZIP10 mRNA was found to be significantly decreased in the intestines and kidneys of hypothyroid rats and increased in those of hyperthyroid rats, indicating that ZIP10 is positively regulated by thyroid hormones. ZIP10 mRNA was also found to be upregulated in invasive and metastatic breast cancer and cell lines, suggesting that ZIP10 could serve as a possible marker for the metastatic phenotype and possibly a target for novel treatment strategies. At least three isoforms of ZIP10 are known to exist.

Specifications

• Accession Number: Q9ULF5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57181
• Name: Human ZIP10 (aa 69-148) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2900042E17Rik; 5430433I10; Kiaa1265; LZT-Hs2; mKIAA1265; Slc39a10; solute carrier family 39 (metal ion transporter), member 10; solute carrier family 39 (zinc transporter), member 10; solute carrier family 39 member 10; Zinc transporter ZIP10; ZIP10; ZIP-10; Zrt- and Irt-like protein 10
• Common Name: ZIP10
• Gene Symbol: SLC39A10
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ERYGENGRLSFFGLEKLLTNLGLGERKVVEINHEDLGHDHVSHLDILAVQEGKHFHSHNHQHSHNHLNSENQTVTSVSTK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining