missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30181615

Invitrogen™ Human ZGLP1 (aa 94-175) Control Fragment Recombinant Protein

Artikelnummer. 30181615
Klik for at se tilgængelige muligheder
Quantity:
100 μL
Pakningsstørrelse:
100µL
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 30181615

Brand: Invitrogen™ RP99247

Please to purchase this item. Need a web account? Register with us today!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (50%), Rat (50%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62064 (PA5-62064. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Glucagon is initially synthesized as proglucagon, which is 180 amino acids in length and is cleaved proteolytically. It contains a region corresponding to Glucagon itself, in addition to a signal peptide, spacer regions and two Glucagon-like peptide sequences. GLP1 is encoded by the fourth exon of the six in the human Glucagon gene. It is 37 amino acids in length and has 48% amino acid sequence homology to Glucagon, and is thought to have arisen by gene duplication. The sequence of GLP1 is conserved across many species, however, indicating that it has a particular function. GLP1 is a potent insulin secretagogue, renders pancreatic beta cells 'glucose-competent' and may be useful in the treatment of diabetes mellitus.
TRUSTED_SUSTAINABILITY

Tekniske data

Accession Number P0C6A0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 100125288
Name Human ZGLP1 (aa 94-175) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias GATA like protein 1; GATA like protein-1; GATA zinc finger domain containing 3; GATAD3; GATA-like 1; GATA-like protein 1; GATA-type zinc finger protein 1; Glp1; GLP-1; ZGLP1; zinc finger, GATA-like protein 1
Common Name ZGLP1
Gene Symbol ZGLP1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LLDRDSKDTQTRISQKGRRLQPPGTPSAPPQRRPRKQLNPCRGTERVDPGFEGVTLKFQIKPDSSLQIIPTYSLPCSSRSQE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.