Invitrogen™ Human ZGLP1 (aa 94-175) Control Fragment Recombinant Protein

Product Code. 30181615

Brand: Invitrogen™ RP99247

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (50%), Rat (50%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62064 (PA5-62064. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Glucagon is initially synthesized as proglucagon, which is 180 amino acids in length and is cleaved proteolytically. It contains a region corresponding to Glucagon itself, in addition to a signal peptide, spacer regions and two Glucagon-like peptide sequences. GLP1 is encoded by the fourth exon of the six in the human Glucagon gene. It is 37 amino acids in length and has 48% amino acid sequence homology to Glucagon, and is thought to have arisen by gene duplication. The sequence of GLP1 is conserved across many species, however, indicating that it has a particular function. GLP1 is a potent insulin secretagogue, renders pancreatic beta cells 'glucose-competent' and may be useful in the treatment of diabetes mellitus.

Specifications

• Accession Number: P0C6A0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 100125288
• Name: Human ZGLP1 (aa 94-175) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: GATA like protein 1; GATA like protein-1; GATA zinc finger domain containing 3; GATAD3; GATA-like 1; GATA-like protein 1; GATA-type zinc finger protein 1; Glp1; GLP-1; ZGLP1; zinc finger, GATA-like protein 1
• Common Name: ZGLP1
• Gene Symbol: ZGLP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LLDRDSKDTQTRISQKGRRLQPPGTPSAPPQRRPRKQLNPCRGTERVDPGFEGVTLKFQIKPDSSLQIIPTYSLPCSSRSQE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining