Invitrogen™ Human ZFP95 (aa 112-256) Control Fragment Recombinant Protein

Product Code. 30181127

Brand: Invitrogen™ RP99734

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51857 (PA5-51857. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Zinc-finger proteins contain DNA-binding domains and have a wide variety of functions, most of which encompass some form of transcriptional activation or repression. A member of the Krüppel C2H2-type zinc-finger protein family, ZKSCAN5, also known as ZFP95, is a 839 amino acid protein containing thirteen C2H2-type zinc fingers, one KRAB A domain and one SCAN box domain. ZKSCAN5 is located in the nucleus and is highly expressed in testis with lower levels of expression in liver, kidney, brain, striated muscle, lung and heart. Many KRAB A box-containing proteins have been shown to function as transcription repressors, suggesting a possible function of ZKSCAN5. As a result of alternative splicing, three transcripts of ZKSCAN5 exist, however one of those transcripts is specific to testis. The mouse homolog of ZKSCAN5 is differentially expressed in spermatogenesis.

Specifications

• Accession Number: Q9Y2L8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23660
• Name: Human ZFP95 (aa 112-256) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI132486; AI326970; hKraba1; KIAA1015; ZFP95; ZFP-95; Zinc finger protein 95; zinc finger protein 95 homolog; zinc finger protein homologous to Zfp95 in mouse; zinc finger protein with KRAB and SCAN domains 5; zinc finger with KRAB and SCAN domains 5; Zkscan5; ZNF914; ZSCAN37
• Common Name: ZFP95
• Gene Symbol: ZKSCAN5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EHHPESGEEAVAVIENIQRELEERRQQIVACPDVLPRKMATPGAVQESCSPHPLTVDTQPEQAPQKPRLLEENALPVLQVPSLPLKDSQELTASLLSTGSQKLVKIEEVADVAVSFILEEWGHLDQSQKSLYRDDRKENYGSITS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining