missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30212096

Invitrogen™ Human ZFP91 (aa 135-195) Control Fragment Recombinant Protein

Product Code. 30212096
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30212096

Brand: Invitrogen™ RP107422

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66765 (PA5-66765. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZFP91 is a member of the zinc finger family of proteins. The gene product contains C2H2 type domains, which are the classical zinc finger domains found in numerous nucleic acid-binding proteins. In addition to the monocistronic transcript originating from this locus, a co-transcribed variant composed of ZFP91 and CNTF sequence has been identified. The monocistronic and co-transcribed variants encode distinct isoforms. The co-transcription of ZFP91 and CNTF has also been observed in mouse.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96JP5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 80829
Name Human ZFP91 (aa 135-195) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 9130014I08Rik; A530054C17Rik; AL024263; AW545902; cocaine attenuated zinc-finger protein; DMS-8; drug resistance-associated sequence in melanoma 8; DSM-8; E3 ubiquitin-protein ligase ZFP91; FKSG11; Penta Zf protein; penta zinc finger protein; PZF; RING-type E3 ubiquitin transferase ZFP91; Zfp91; Zfp-91; ZFP91 zinc finger protein; ZFP91 zinc finger protein, atypical E3 ubiquitin ligase; zinc finger protein 757; zinc finger protein 91; zinc finger protein 91 homolog; zinc finger protein 91-like protein; zinc finger protein homologous to Zfp91 in mouse; Zinc finger protein PZF; ZNF757
Common Name ZFP91
Gene Symbol ZFP91
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SALPQEVSIAASRPSRGWRSSRTSVSRHRDTENTRSSRSKTGSLQLICKSEPNTDQLDYDV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.