Invitrogen™ Human ZFP82 (aa 109-164) Control Fragment Recombinant Protein

Product Code. 30198527

Brand: Invitrogen™ RP100460

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (61%), Rat (61%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-111340 (PA5-111340, PA5-63862 (PA5-63862. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZFP82 is a protein coding gene, and may be involved in transcriptional regulation.

Specifications

• Accession Number: Q8N141
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 284406
• Name: Human ZFP82 (aa 109-164) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A030010D05; Kiaa1948; Krab16; Mszf3; ZFP82; Zfp-82; ZFP82 zinc finger protein; zinc finger protein 545; Zinc finger protein 82; zinc finger protein 82 homolog; zinc finger protein 85; ZNF545
• Common Name: ZFP82
• Gene Symbol: ZFP82
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NHGLKGLILKNDWESTGKIEGQERPQEGYFSSVKMPSEKVSSYQKRTSVTPHQRLH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining