Invitrogen™ Human ZFP57 (aa 71-155) Control Fragment Recombinant Protein

Product Code. 30182184

Brand: Invitrogen™ RP99612

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (31%), Rat (31%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61456 (PA5-61456. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a zinc finger protein containing a KRAB domain. Studies in mouse suggest that this protein may function as a transcriptional repressor. Mutations in this gene have been associated with transient neonatal diabetes mellitus type 1 (TNDM1).

Specifications

• Accession Number: Q9NU63
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 346171
• Name: Human ZFP57 (aa 71-155) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: bA145L22; bA145L22.2; C6orf40; DADB-25P22.4; G19; TNDM1; ZFP57; Zfp-57; ZFP57 zinc finger protein; zinc finger protein 57; Zinc finger protein 57 homolog; zinc finger protein 698; ZNF698
• Common Name: ZFP57
• Gene Symbol: ZFP57
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PELITKLEQEEEQWREFVHLPNTEGLSEGKKKELREQHPSLRDEGTSDDKVFLACRGAGQCPLSAPAGTMDRTRVLQASQAGPPF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining