Invitrogen™ Human ZFP2 (aa 3-101) Control Fragment Recombinant Protein

Product Code. 30201850

Brand: Invitrogen™ RP93656

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (54%), Rat (54%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54774 (PA5-54774. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Probable transcription factor involved in neuronal differentiation and/or phenotypic maintenance.

Specifications

• Accession Number: Q6ZN57
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 80108
• Name: Human ZFP2 (aa 3-101) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9930007F06Rik; Fnp-2; Mkr2; mkr-2; mszf87; Protein mKR2; Zfp2; zfp-2; ZFP2 zinc finger protein; zinc finger protein 2; Zinc finger protein 2 homolog; zinc finger protein 751; ZNF751
• Common Name: ZFP2
• Gene Symbol: ZFP2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: REGIWHSTLGETWEPNNWLEGQQDSHLSQVGVTHKETFTEMRVCGGNEFERCSSQDSILDTQQSIPMVKRPHNCNSHGEDATQNSELIKTQRMFVGKKI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining