Invitrogen™ Human ZFHX4 (aa 437-562) Control Fragment Recombinant Protein

Product Code. 30208842

Brand: Invitrogen™ RP89306

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54897 (PA5-54897. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May play a role in neural and muscle differentiation. May be involved in transcriptional regulation.

Spécification

• Accession Number: Q86UP3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79776
• Name: Human ZFHX4 (aa 437-562) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A930021B15; C130041O22Rik; LOW QUALITY PROTEIN: zinc finger homeobox protein 4; RGD1563022; ZFH4; Zfh-4; Zfhx4; ZHF4; zinc finger homeobox 4; zinc finger homeobox protein 4; zinc finger homeobox protein 4; LOW QUALITY PROTEIN: zinc finger homeobox protein 4; zinc finger homeodomain 4; zinc finger homeodomain protein 4; zinc-finger homeodomain protein 4
• Common Name: ZFHX4
• Gene Symbol: ZFHX4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ESKDQENNCERPKESNVLHPNGECPVKSEPTEPGDEDEEDAYSNELDDEEVLGELTDSIGNKDFPLLNQSISPLSSSVLKFIEKGTSSSSATVSDDTEKKKQTAAVRASGSVASNYGISGKDFADA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining