Invitrogen™ Human ZFAND4 (aa 103-194) Control Fragment Recombinant Protein

Product Code. 30212944

Brand: Invitrogen™ RP109387

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140268 (PA5-140268. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZFAND4 is a protein coding gene.

Specifications

• Accession Number: Q86XD8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 93550
• Name: Human ZFAND4 (aa 103-194) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AN1, ubiquitin-like, homolog; AN1-type zinc finger and ubiquitin domain-containing protein 1; AN1-type zinc finger and ubiquitin domain-containing protein-like 1; AN1-type zinc finger protein 4; ANUBL1; Zfand4; zinc finger AN1-type containing 4; zinc finger, AN1-type domain 4
• Common Name: ZFAND4
• Gene Symbol: ZFAND4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GPINTRRVPTDDPLRKMAEYLDSSRVEVWEKTSCSKQVTFLVYQEGDQLNFFPAVDRGDGTLTPLSDSSKKIDFHLHVLRRKGEHRMSGGSM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining