Invitrogen™ Human ZFAND3 (aa 1-80) Control Fragment Recombinant Protein

Product Code. 30204968

Brand: Invitrogen™ RP91675

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53488 (PA5-53488. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZFAND3 (Zinc Finger AN1-Type Containing 3) is a Protein Coding gene and also known as Testis expressed sequence 27.

Specifications

• Accession Number: Q9H8U3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 60685
• Name: Human ZFAND3 (aa 1-80) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AN1-type zinc finger protein 3; AW539211; RNF1; TEG-27; testis expressed gene 27; testis expressed sequence 27; Testis-expressed protein 27; testis-expressed sequence 27; TEX27; ZFAND3; zinc finger AN1-type containing 3; zinc finger, AN1-type domain 3
• Common Name: ZFAND3
• Gene Symbol: ZFAND3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MGDAGSERSKAPSLPPRCPCGFWGSSKTMNLCSKCFADFQKKQPDDDSAPSTSNSQSDLFSEETTSDNNNTSITTPTLSP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining