Invitrogen™ Human ZFAND2B (aa 194-257) Control Fragment Recombinant Protein

Product Code. 30194757

Brand: Invitrogen™ RP96164

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57182 (PA5-57182. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein containing AN1-type zinc-fingers and ubiquitin-interacting motifs. The encoded protein likely associates with the proteosome to stimulate the degradation of toxic or misfolded proteins. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Specifications

• Accession Number: Q8WV99
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 130617
• Name: Human ZFAND2B (aa 194-257) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110060O18Rik; AIRAPL; AIRAP-like protein; AN1-type zinc finger protein 2 B; arsenite-inducible RNA-associated protein-like protein; C81256; ZFAND2B; zinc finger AN1-type containing 2 B; zinc finger, AN1 type domain 2 B; zinc finger, AN1-type domain 2 B
• Common Name: ZFAND2B
• Gene Symbol: ZFAND2B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NGLSEDEALQRALEMSLAETKPQVPSCQEEEDLALAQALSASEAEYQRQQAQSRSSKPSNCSLC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining