Invitrogen™ Human ZEB1 (aa 565-694) Control Fragment Recombinant Protein

Product Code. 30193799

Brand: Invitrogen™ RP100723

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82982 (PA5-82982. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZEB1 (Zinc finger E-box-binding homeobox 1) acts as a transcriptional repressor. It inhibits interleukin-2 (IL-2) gene expression. ZEB1 enhances or represses the promoter activity of the ATP1A1 gene depending on the quantity of cDNA and depending on the cell type. It represses E-cadherin promoters and induces an epithelial-mesenchymal transition (EMT) by recruiting SMARCA4/BRG1. ZEB1 also represses BCL6 transcription in the presence of the corepressor CTBP1. It postively regulates neuronal differentiation and represses RCOR1 transcription activation during neurogenesis. Mutations in the gene can result in corneal dystrophy, posterior polymorphous and corneal dystrophy, Fuchs endothelial 6.

Specifications

• Accession Number: P37275
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6935
• Name: Human ZEB1 (aa 565-694) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: [delta]EF1; 3110032K11Rik; AREB6; BZP; Delta EF1; delta-crystallin enhancer binding factor 1; deltaEF1; DELTA-EF1; FECD6; LOW QUALITY PROTEIN: zinc finger E-box-binding homeobox 1; MEB1; MGC133261; Negative regulator of IL2; Nil2; NIL2A; NIL-2 A; NIL-2-A; NIL-2-A zinc finger protein; OTTHUMP00000019405; posterior polymorphous corneal dystrophy 3; PPCD3; RP11-472N13.4; Tcf18; TCF8; TCF-8; Transcription factor 8; transcription factor 8 (represses interleukin 2 expression); Tw; twirler; ZEB; Zeb1; Zfhep; Zfh x 1 A; Zf x 1 A; Zf x 1 ha; zinc finger E-box binding homeobox 1; zinc finger E-box-binding homeobox 1; Zinc finger homeobox protein 1 A; zinc finger homeodomain enhancer-binding protein
• Common Name: ZEB1
• Gene Symbol: ZEB1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGST
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining