missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30201094

Invitrogen™ Human ZDHHC18 (aa 328-385) Control Fragment Recombinant Protein

Product Code. 30201094
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30201094

Brand: Invitrogen™ RP91203

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59114 (PA5-59114. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Zinc-finger proteins contain DNA-binding domains and have a wide variety of functions, most of which encompass some form of transcriptional activation or repression. ZDHHC1 (zinc finger, DHHC-type containing 1), also known as ZNF377 (zinc finger protein 377) or C16orf1, is a 485 amino acid multi-pass membrane protein that contains one DHHC-type zinc finger. Expressed in fetal heart, lung and kidney and also present in adult lung and pancreas, ZDHHC1 functions as a palmitoyltransferase that catalyzes the conversion of palmitoyl-CoA and protein-cysteine to S-palmitoyl protein and CoA. Like ZDHHC1, ZDHHC5, ZDHHC6, ZDHHC7 and ZDHHC18 each contain one DHHC-type zinc finger through which they convey palmitoyltransferase activity against a broad range of substrates, including H-Ras, SNAP 25 and GABAA R proteins.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NUE0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 84243
Name Human ZDHHC18 (aa 328-385) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias DHHC18; DHHC-18; membrane-associated DHHC18 zinc finger protein; palmitoyltransferase ZDHHC18; Zdhhc18; Zinc finger DHHC domain-containing protein 18; zinc finger DHHC-type containing 18; zinc finger, DHHC domain containing 18; zinc finger, DHHC-type containing 18
Common Name ZDHHC18
Gene Symbol ZDHHC18
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NPYSHKSIITNCCAVLCGPLPPSLIDRRGFVQSDTVLPSPIRSDEPACRAKPDASMVG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.