Invitrogen™ Human ZDHHC16 (aa 290-369) Control Fragment Recombinant Protein

Product Code. 30198111

Brand: Invitrogen™ RP91045

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58965 (PA5-58965. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZDHHC16 (zinc finger, DHHC-type containing 16), also known as APH2, is a 377 amino acid multi-pass membrane protein that localizes to the endoplasmic reticulum and contains one DHHC-type zinc finger. Existing as multiple alternatively spliced isoforms, ZDHHC16 interacts with c-Abl and catalyzes the conversion of Palmitoyl-CoA and protein-cysteine to S-palmitoyl protein and CoA. Via its association with c-Abl, ZDHHC16 may be involved in the regulation of apoptosis. The gene encoding ZDHHC16 maps to human chromosome 10, which houses over 1,200 genes and comprises nearly 4.5% of the human genome. Defects in some of the genes that map to chromosome 10 are associated with Charcot-Marie Tooth disease, Jackson-Weiss syndrome, Usher syndrome, nonsyndromatic deafness, Wolman's syndrome, Cowden syndrome, multiple endocrine neoplasia type 2 and porphyria.

Specifications

• Accession Number: Q969W1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84287
• Name: Human ZDHHC16 (aa 290-369) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1500015N03Rik; Abl-philin 2; ablphilin-2; Aph2; DHHC-16; membrane-associated DHHC16 zinc finger protein; Palmitoyltransferase ZDHHC16; probable palmitoyltransferase ZDHHC16; UNQ2570/PRO6258; Zdhhc16; Zinc finger DHHC domain-containing protein 16; zinc finger DHHC-type containing 16; zinc finger, DHHC domain containing 16; zinc finger, DHHC-type containing 16
• Common Name: ZDHHC16
• Gene Symbol: ZDHHC16
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VLISRGETSIERHINKKERRRLQAKGRVFRNPYNYGCLDNWKVFLGVDTGRHWLTRVLLPSSHLPHGNGMSWEPPPWVTA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining