Invitrogen™ Human ZDHHC15 (aa 99-138) Control Fragment Recombinant Protein

Product Code. 30204149

Brand: Invitrogen™ RP110258

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144921 (PA5-144921. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene belongs to the DHHC palmitoyltransferase family. Mutations in this gene are associated with mental retardatio X-linked type 91 (MRX91). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009].

Specifications

• Accession Number: Q96MV8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 158866
• Name: Human ZDHHC15 (aa 99-138) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6030457O13Rik; DHHC-15; membrane-associated DHHC15 zinc finger protein; MRX91; Palmitoyltransferase ZDHHC15; UNQ1969/PRO4501; Zdhhc15; Zinc finger DHHC domain-containing protein 15; zinc finger DHHC-type containing 15; zinc finger, DHHC domain containing 15; zinc finger, DHHC-type containing 15
• Common Name: ZDHHC15
• Gene Symbol: ZDHHC15
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NEERPEVQKQMLVDMAKKLPVYTRTGSGAVRFCDRCHLIK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining