Invitrogen™ Human ZDHHC11B (aa 1-37) Control Fragment Recombinant Protein

Product Code. 30195538

Brand: Invitrogen™ RP91241

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (43%), Rat (43%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63500 (PA5-63500. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZDHHC11B (Zinc Finger DHHC-Type Containing 11B) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene includeprotein-cysteine S-palmitoyltransferase activity. An important paralog of this gene isZDHHC11.

Specifications

• Accession Number: P0C7U3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 653082
• Name: Human ZDHHC11B (aa 1-37) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: DHHC-11 B; probable palmitoyltransferase ZDHHC11B; ZDHHC11B; Zinc finger DHHC domain-containing protein 11 B; zinc finger DHHC-type containing 11 B; zinc finger, DHHC-type containing 11 B
• Common Name: ZDHHC11B
• Gene Symbol: ZDHHC11B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MDTRSGSQCSVTPEAIRNNEELVLPPRISRVNGWSLP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining