Invitrogen™ Human ZDHC3 (aa 194-241) Control Fragment Recombinant Protein

Product Code. 30193802

Brand: Invitrogen™ RP91170

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (40%), Rat (40%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53460 (PA5-53460. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Golgi-localized palmitoyltransferase that catalyzes the addition of palmitate onto various protein substrates (PubMed:19001095, PubMed:21926431, PubMed:22240897, PubMed:23034182, PubMed:22314500). Plays an important role in G protein-coupled receptor signaling pathways involving GNAQ and potentially other heterotrimeric G proteins by regulating their dynamic association with the plasma membrane (PubMed:19001095). Palmitoylates ITGA6 and ITGB4, thereby regulating the alpha-6/beta-4 integrin localization, expression and function in cell adhesion to laminin (PubMed:22314500). Plays a role in the TRAIL-activated apoptotic signaling pathway most probably through the palmitoylation and localization to the plasma membrane of TNFRSF10A (PubMed:22240897). In the brain, by palmitoylating the gamma subunit GABRG2 of GABA(A) receptors and regulating their postsynaptic accumulation, plays a role in synaptic GABAergic inhibitory function and GABAergic innervation. Palmitoylates the neuronal protein GAP43 which is also involved in the formation of GABAergic synapses. Palmitoylates NCDN thereby regulating its association with endosome membranes. Probably palmitoylates PRCD and is involved in its proper localization within the photoreceptor. Could mediate the palmitoylation of NCAM1 and regulate neurite outgrowth. Could palmitoylate DNAJC5 and regulate its localization to Golgi membranes. Also constitutively palmitoylates DLG4. May also palmitoylate SNAP25. Could palmitoylate the glutamate receptors GRIA1 and GRIA2 but this has not been confirmed in vivo. Could also palmitoylate the D(2) dopamine receptor DRD2 (PubMed:26535572). [UniProt]

Specifications

• Accession Number: Q9NYG2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51304
• Name: Human ZDHC3 (aa 194-241) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110020O22Rik; 1810006O10Rik; 2210017C02Rik; DHHC1 protein; DHHC-3; GABA-A receptor-associated membrane protein 1; Godz; Golgi apparatus-specific protein with DHHC zinc finger domain; golgi-specific DHHC Zinc Finger Protein; Gramp1; HSD49; Palmitoyltransferase ZDHHC3; Protein DHHC1; Zdhhc3; Zfp373; Zinc finger DHHC domain-containing protein 3; zinc finger DHHC-type containing 3; zinc finger protein 373; zinc finger, DHHC domain containing 3; zinc finger, DHHC-type containing 3; ZNF373
• Common Name: ZDHC3
• Gene Symbol: ZDHHC3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FLHCFEEDWTTYGLNREEMAETGISLHEKMQPLNFSSTECSSFSPPTT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining