Invitrogen™ Human ZDBF2 (aa 449-530) Control Fragment Recombinant Protein

Product Code. 30211724

Brand: Invitrogen™ RP106273

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (38%), Rat (38%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65608 (PA5-65608. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein containing DBF4-type zinc finger domains. This gene is imprinted and paternally expressed in lymphocytes but is more stochastically expressed in the placenta. Alternative splicing results in multiple transcript variants.

Specifications

• Accession Number: Q9HCK1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57683
• Name: Human ZDBF2 (aa 449-530) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: DBF4-type zinc finger-containing protein 2; KIAA1571; ZDBF2; zinc finger DBF-type containing 2; zinc finger, DBF-type containing 2
• Common Name: ZDBF2
• Gene Symbol: ZDBF2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KISSDCDDILHLVTNQSQMIVKEISLQNARHISLVDQSYESSSSETNFDCDASPQSTSDYPQQSVTEVNLPKEVHIGLVDKN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining