Invitrogen™ Human ZCCHC12 (aa 205-292) Control Fragment Recombinant Protein

Product Code. 30195550

Brand: Invitrogen™ RP95189

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56615 (PA5-56615. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Transcriptional coactivator in the bone morphogenetic protein (BMP)-signaling pathway. It positively modulates BMP signaling by interacting with SMAD1 and associating with CBP in the transcription complex. It contributes to the BMP-induced enhancement of cholinergic-neuron-specific gene expression.

Specifications

• Accession Number: Q6PEW1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 170261
• Name: Human ZCCHC12 (aa 205-292) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: paraneoplastic Ma antigen family member 7 A; PNMA7A; SIZN; SIZN1; Smad-interacting zinc finger protein 1; ZCCHC12; Zinc finger CCHC domain-containing protein 12; zinc finger CCHC-type containing 12; zinc finger, CCHC domain containing 12
• Common Name: ZCCHC12
• Gene Symbol: ZCCHC12
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RLPNFLELIRMVREEEDWDDAFIKRKRPKRSESMVERAVSPVAFQGSPPIVIGSADCNVIEIDDTLDDSDEDVILVESQDPPLPSWGA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining